PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11714.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 122aa    MW: 13518 Da    PI: 10.4114
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11714.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.7e-1461105347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
        PK11714.1  61 PWTEEEHRTFLIGLEKLGKGDWRGISRSFVTTRTPTQVASHAQKY 105
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.80454110IPR017930Myb domain
SuperFamilySSF466892.84E-1855110IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-1857109IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-1158104IPR009057Homeodomain-like
SMARTSM007173.6E-958108IPR001005SANT/Myb domain
CDDcd001671.90E-861106No hitNo description
PfamPF002491.9E-1161105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MDCLMHSSLS SPSSSPSSSS SAIIALDETN ISDHHKAATS IGYLSDGLII GRPQERKKGV  60
PWTEEEHRTF LIGLEKLGKG DWRGISRSFV TTRTPTQVAS HAQKYFLRQA TLDKKKRRSS  120
LX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113117KKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571792.12e-48PREDICTED: transcription factor MYB1R1 isoform X2
SwissprotQ8S9H72e-33DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068U6I04e-49A0A068U6I0_COFCA; Uncharacterized protein
STRINGGLYMA05G36290.13e-46(Glycine max)
STRINGGLYMA08G03330.13e-46(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.15e-39MYB_related family protein